PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_01708
Common NameKK1_001746
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 317aa    MW: 35405.4 Da    PI: 7.2413
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_01708genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.52.6e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd  lv +++++G+g+W+++++  g+ R+ k+c++rw +yl
    C.cajan_01708 14 KGPWTPEEDIMLVSYIQEHGSGNWRSVPANAGLMRCSKSCRLRWINYL 61
                     79********************************************97 PP

2Myb_DNA-binding49.68.9e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E++ ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
    C.cajan_01708  67 RGNFTEHEEKMIIHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.485961IPR017930Myb domain
SuperFamilySSF466891.16E-3011108IPR009057Homeodomain-like
SMARTSM007175.5E-131363IPR001005SANT/Myb domain
PfamPF002492.1E-161461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-231568IPR009057Homeodomain-like
CDDcd001671.08E-101661No hitNo description
PROSITE profilePS5129423.90462116IPR017930Myb domain
SMARTSM007171.5E-1566114IPR001005SANT/Myb domain
PfamPF002492.3E-1467112IPR001005SANT/Myb domain
CDDcd001671.12E-1069112No hitNo description
Gene3DG3DSA:1.10.10.605.6E-2569117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MGRPPCCDKI GTKKGPWTPE EDIMLVSYIQ EHGSGNWRSV PANAGLMRCS KSCRLRWINY  60
LRPGIKRGNF TEHEEKMIIH LQALLGNRWA AIASYLPQRT DNDIKNYWNT HLKKKLKQND  120
QSGSDEGVHH PEGHSCSSSS SHSKGQWERR LQTDIKMAKQ ALCEALSLHK PATHVESDTK  180
PSSSSHHHPN ASSSSSPYAS SYENISRLLE NWMKPPNSTE TNPLGYHSFS NVINNTRGSS  240
SSEGAYSTTT TTTTCTQDYA FDESFLILNS SKHNGSPPLE THVPLTLLEN WLFDDGAVQC  300
DEDLMNISLE KSTAGLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-25141167108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ9377831e-128KJ937783.1 Caragana korshinskii MYBJ2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003549675.21e-155PREDICTED: myb-related protein 306
SwissprotP813921e-110MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A151SL080.0A0A151SL08_CAJCA; Myb-related protein 306 family
STRINGGLYMA17G10820.11e-155(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101634115
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47600.14e-97myb domain protein 94